PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006404m
Common NameCARUB_v10006404mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 612aa    MW: 69660.3 Da    PI: 8.7957
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006404mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.2e-14329373146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+ WT+eEd++l  av ++G  +W ++a+ +  gRt+ qc +rw k
  Carubv10006404m 329 RKEWTAEEDDQLRAAVDLFGETDWQSVANVLH-GRTGPQCSNRWKK 373
                      789*****************************.***********98 PP

2Myb_DNA-binding53.74.8e-17382424144
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      +++W+ eEd++l+ av+++G+++W++Ia+ ++ gRt+ qc +rw
  Carubv10006404m 382 KQKWSSEEDKRLKVAVTLFGTKNWSKIAQFVP-GRTGTQCLERW 424
                      79******************************.*********** PP

3Myb_DNA-binding50.25.7e-16435477246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g+WT+eEd +l +a k++G   W+++a++m  gRt+ qc  rw +
  Carubv10006404m 435 GKWTKEEDAKLREAMKEYGHC-WSKVASYMS-GRTDSQCAKRWKS 477
                      79*****************99.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.646177270IPR017877Myb-like domain
SMARTSM0071718181272IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-4184200IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-4246282IPR009057Homeodomain-like
SuperFamilySSF466894.9E-11254320IPR009057Homeodomain-like
PROSITE profilePS500907.956271323IPR017877Myb-like domain
SMARTSM007170.0014275325IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-10283336IPR009057Homeodomain-like
SuperFamilySSF466897.9E-18308377IPR009057Homeodomain-like
PROSITE profilePS5129420.066324379IPR017930Myb domain
SMARTSM007173.5E-13328377IPR001005SANT/Myb domain
PfamPF002492.2E-12329373IPR001005SANT/Myb domain
CDDcd001673.56E-10331375No hitNo description
Gene3DG3DSA:1.10.10.601.1E-15337377IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-19379429IPR009057Homeodomain-like
SuperFamilySSF466893.27E-29379475IPR009057Homeodomain-like
PROSITE profilePS5129416.362380428IPR017930Myb domain
SMARTSM007174.2E-15381430IPR001005SANT/Myb domain
PfamPF002495.6E-15382425IPR001005SANT/Myb domain
CDDcd001671.14E-11384428No hitNo description
PROSITE profilePS5129423.917429483IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-19430478IPR009057Homeodomain-like
SMARTSM007171.2E-14433481IPR001005SANT/Myb domain
PfamPF002491.0E-14435478IPR001005SANT/Myb domain
CDDcd001671.39E-11436478No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MNDSIRKNKK QVHALDNEPS TEILSRSNTC ESFPDHGKSV VTVSDSDTSG DHLETCQSES  60
SSFPEAAKAF VNAIQKNRSY QSLLRRKLSE IEATIEQNEK HKKNVKIVKD FEASCKRITK  120
QALSQMKDPR VELISARKSE PASDSTEDND KKTSPLMLGP LENACVANYR MALEKYPVSV  180
DRRSWTSKEK ESLAKGLKQQ VQNALIHEAF ERSSDLEGSA DDVNTILEGI KNLEITPEMI  240
RQYLPKVNWD QLDIKNRSGA ECEAQWMSSE DPLINNGPWT VAEDNYLRLI TQNKGFTDWL  300
DIAVSLGTNR TPFHCLARYQ RSLNPYVLRK EWTAEEDDQL RAAVDLFGET DWQSVANVLH  360
GRTGPQCSNR WKKSLHPSRT KKQKWSSEED KRLKVAVTLF GTKNWSKIAQ FVPGRTGTQC  420
LERWGNSLDP KLKFGKWTKE EDAKLREAMK EYGHCWSKVA SYMSGRTDSQ CAKRWKSLYP  480
HLAHLRQEAR RLQRETTIGN FVDRESERPD LVVGDFLALA EESLEPEPTL KKKRRARSLS  540
LEGKYLRKLK RISVRAENED EPSQESYCRD GLGGKFPTNN LQLFSNAVYK SHSINSSSTV  600
QHSSGSFELA F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C7e-332384779159MYB PROTO-ONCOGENE PROTEIN
1h88_C7e-332384779159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1530534KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282796.10.0hypothetical protein CARUB_v10006404mg
TrEMBLR0GG120.0R0GG12_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_70019620.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65042744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1